Lineage for d3id6c_ (3id6 C:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1175720Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1175721Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1176809Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1176810Protein automated matches [190689] (23 species)
    not a true protein
  7. 1176906Species Sulfolobus solfataricus [TaxId:2287] [189014] (1 PDB entry)
  8. 1176907Domain d3id6c_: 3id6 C: [178242]
    automated match to d1prya_
    protein/RNA complex; complexed with sam

Details for d3id6c_

PDB Entry: 3id6 (more details), 2.6 Å

PDB Description: crystal structure of sulfolobus solfataricus nop5 (1-262) and fibrillarin complex
PDB Compounds: (C:) Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase

SCOPe Domain Sequences for d3id6c_:

Sequence, based on SEQRES records: (download)

>d3id6c_ c.66.1.0 (C:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
itvkqtnmeniyecefndgsfrlctrnlvpnfnvygerlikyegveyrewnafrsklaga
ilkglktnpirkgtkvlylgaasgttishvsdiielngkaygvefsprvvrelllvaqrr
pnifplladarfpqsyksvvenvdvlyvdiaqpdqtdiaiynakfflkvngdmllvikar
sidvtkdpkeiykteveklensnfetiqiinldpydkdhaivlskyk

Sequence, based on observed residues (ATOM records): (download)

>d3id6c_ c.66.1.0 (C:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
itvkqtnmeniyecefndgsfrlctrnlvpnfnvygerlikyegveyrewnafrsklaga
ilkglktnpirkgtkvlylgaasgttishvsdiielngkaygvefsprvvrelllvaqrr
pnifplladarfpqsyksvvenvdvlyvdiaqpdqtdiaiynakfflkvngdmllvikkd
pkeiykteveklensnfetiqiinldpydkdhaivlskyk

SCOPe Domain Coordinates for d3id6c_:

Click to download the PDB-style file with coordinates for d3id6c_.
(The format of our PDB-style files is described here.)

Timeline for d3id6c_: