Lineage for d3iaid_ (3iai D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2077896Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2077897Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2078811Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2078812Protein automated matches [191011] (13 species)
    not a true protein
  7. 2078893Species Human (Homo sapiens) [TaxId:9606] [188766] (12 PDB entries)
  8. 2078900Domain d3iaid_: 3iai D: [178214]
    Other proteins in same PDB: d3iaia2
    automated match to d1rj5a_
    complexed with azm, gol, po4, trs, zn

Details for d3iaid_

PDB Entry: 3iai (more details), 2.2 Å

PDB Description: crystal structure of the catalytic domain of the tumor-associated human carbonic anhydrase ix
PDB Compounds: (D:) Carbonic anhydrase 9

SCOPe Domain Sequences for d3iaid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iaid_ b.74.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shwryggdppwprvspacagrfqspvdirpqlaafspalrplellgfqlpplpelrlrnn
ghsvqltlppglemalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlsta
farvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallp
sdfsryfqyegslttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqlnfrat
qplngrvieasfp

SCOPe Domain Coordinates for d3iaid_:

Click to download the PDB-style file with coordinates for d3iaid_.
(The format of our PDB-style files is described here.)

Timeline for d3iaid_: