SCOPe 2.06: Domain d3i5je_: 3i5j E:

Lineage for d3i5je_ (3i5j E:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
   corner-like structure formed by two sheets and filled in with 2-3 helices

4. Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family)
   duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold

5. Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins)
   note: the solution structure determinations disagree in the relative orientations of two motifs

6. Protein Toluene-4-monooxygenase catalytic effector protein [64394] (1 species)

7. Species Pseudomonas mendocina [TaxId:300] [64395] (18 PDB entries)

8. Domain d3i5je_: 3i5j E: [178098]
   Other proteins in same PDB: d3i5ja_, d3i5jc_
   automated match to d1g10a_
   complexed with fe

Details for d3i5je_

PDB Entry: 3i5j, 1.9 Å

PDB Description: Diferric Resting State Toluene 4-Monooxygenase HD complex

PDB Compounds: (E:) toluene-4-monooxygenase system protein d

SCOPe Domain Sequences for d3i5je_:

Sequence; same for both SEQRES and ATOM records:

>d3i5je_ d.137.1.1 (E:) Toluene-4-monooxygenase catalytic effector protein {Pseudomonas mendocina [TaxId: 300]}
stladqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltr
ktleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm

Timeline for d3i5je_:

• d3i5je_ first appeared in SCOPe 2.01
  
• d3i5je_ appears in SCOPe 2.05
  
• d3i5je_ appears in SCOPe 2.07
  
• d3i5je_ appears in the current release, SCOPe 2.08