Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
Protein automated matches [190513] (36 species) not a true protein |
Species Todarodes pacificus [TaxId:6637] [189005] (4 PDB entries) |
Domain d3i5gb_: 3i5g B: [178094] Other proteins in same PDB: d3i5gc_ automated match to d1kk7y_ complexed with ca, mli |
PDB Entry: 3i5g (more details), 2.6 Å
SCOPe Domain Sequences for d3i5gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i5gb_ a.39.1.0 (B:) automated matches {Todarodes pacificus [TaxId: 6637]} rvklsqrqmqelkeaftmidqdrdgfigmedlkdmfsslgrvppddelnamlkecpgqln ftafltlfgekvsgtdpedalrnafsmfdedgqgfipedylkdllenmgdnfskeeiknv wkdaplknkqfnynkmvdikgkaed
Timeline for d3i5gb_: