Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Bacillus thuringiensis [TaxId:527023] [189003] (1 PDB entry) |
Domain d3i4fa_: 3i4f A: [178084] automated match to d1q7ca_ |
PDB Entry: 3i4f (more details), 2.39 Å
SCOPe Domain Sequences for d3i4fa_:
Sequence, based on SEQRES records: (download)
>d3i4fa_ c.2.1.0 (A:) automated matches {Bacillus thuringiensis [TaxId: 527023]} fvrhalitagtkglgkqvtekllakgysvtvtyhsdttametmketykdveerlqfvqad vtkkedlhkiveeamshfgkidflinnagpyvferkklvdyeedewnemiqgnltavfhl lklvvpvmrkqnfgriinygfqgadsapgwiyrsafaaakvglvsltktvayeeaeygit anmvcpgdiigemkeatiqearqlkehntpigrsgtgediartisflceddsdmitgtii evtgavdvih
>d3i4fa_ c.2.1.0 (A:) automated matches {Bacillus thuringiensis [TaxId: 527023]} fvrhalitagtkglgkqvtekllakgysvtvtyhsdttametmketykdveerlqfvqad vtkkedlhkiveeamshfgkidflinnagpyvferkklvdyeedewnemiqgnltavfhl lklvvpvmrkqnfgriinygfqgadsapgwiyrsafaaakvglvsltktvayeeaeygit anmvcpgdiigemkeatiqearqlrsgtgediartisflceddsdmitgtiievtgavdv ih
Timeline for d3i4fa_: