SCOPe 2.03: Domain d3i4dl_: 3i4d L:

Lineage for d3i4dl_ (3i4d L:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (5 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [186985] (31 PDB entries)

8. Domain d3i4dl_: 3i4d L: [178082]
   Other proteins in same PDB: d3i4dh1, d3i4dh2
   automated match to d1aigl_
   complexed with bcl, bph, cdl, cl, dio, fe, gol, ht3, hto, k, lda, po4, spo, u10, uq1

Details for d3i4dl_

PDB Entry: 3i4d, 2.01 Å

PDB Description: Photosynthetic reaction center from rhodobacter sphaeroides 2.4.1

PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d3i4dl_:

Sequence; same for both SEQRES and ATOM records:

>d3i4dl_ f.26.1.1 (L:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d3i4dl_:

• d3i4dl_ first appeared in SCOPe 2.01
  
• d3i4dl_ appears in SCOPe 2.02
  
• d3i4dl_ appears in SCOPe 2.04
  
• d3i4dl_ appears in the current release, SCOPe 2.08