SCOPe 2.08: Domain d3i47a1: 3i47 A:4-260

Lineage for d3i47a1 (3i47 A:4-260)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (71 species)
   not a true protein

7. Species Legionella pneumophila [TaxId:272624] [189004] (1 PDB entry)

8. Domain d3i47a1: 3i47 A:4-260 [178080]
   Other proteins in same PDB: d3i47a2
   automated match to d1uiya_

Details for d3i47a1

PDB Entry: 3i47, 1.58 Å

PDB Description: crystal structure of putative enoyl coa hydratase/isomerase (crotonase) from legionella pneumophila subsp. pneumophila str. philadelphia 1

PDB Compounds: (A:) Enoyl CoA hydratase/isomerase (Crotonase)

SCOPe Domain Sequences for d3i47a1:

Sequence; same for both SEQRES and ATOM records:

>d3i47a1 c.14.1.0 (A:4-260) automated matches {Legionella pneumophila [TaxId: 272624]}
sdllyeiqdkvglltmnriskhnafdnqlltemrirldsaindtnvrvivlkangkhfsa
gadltwmqsmanfteeenledslvlgnlmysisqspkptiamvqgaafgggaglaaacdi
aiastsarfcfsevklglipavispyvvraigeraakmlfmsaevfdatrayslnlvqhc
vpddtlleftlkyasqisnnapeavknskqlaqyvankkideelvrytasliahkrvsde
gqeglkaflnkeipnwn

Timeline for d3i47a1:

• d3i47a1 first appeared in SCOPe 2.01, called d3i47a_
  
• d3i47a1 appears in SCOPe 2.07