Lineage for d3i42a_ (3i42 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 982188Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 982514Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 982515Protein automated matches [190131] (16 species)
    not a true protein
  7. 982544Species Methylobacillus flagellatus [TaxId:265072] [189002] (1 PDB entry)
  8. 982545Domain d3i42a_: 3i42 A: [178077]
    automated match to d1vlzb_

Details for d3i42a_

PDB Entry: 3i42 (more details), 2.15 Å

PDB Description: structure of response regulator receiver domain (chey-like) from methylobacillus flagellatus
PDB Compounds: (A:) Response regulator receiver domain protein (CheY-like)

SCOPe Domain Sequences for d3i42a_:

Sequence, based on SEQRES records: (download)

>d3i42a_ c.23.1.0 (A:) automated matches {Methylobacillus flagellatus [TaxId: 265072]}
slqqalivedyqaaaetfkellemlgfqadyvmsgtdalhamstrgydavfidlnlpdts
glalvkqlralpmektskfvavsgfakndlgkeacelfdfylekpidiaslepilqsie

Sequence, based on observed residues (ATOM records): (download)

>d3i42a_ c.23.1.0 (A:) automated matches {Methylobacillus flagellatus [TaxId: 265072]}
slqqalivedyqaaaetfkellemlgfqadyvmsgtdalhamstrgydavfidlnlpdts
glalvkqlralpmektskfvavsgfkndlgkeacelfdfylekpidiaslepilqsie

SCOPe Domain Coordinates for d3i42a_:

Click to download the PDB-style file with coordinates for d3i42a_.
(The format of our PDB-style files is described here.)

Timeline for d3i42a_: