SCOPe 2.04: Domain d1ocoh_: 1oco H:

Lineage for d1ocoh_ (1oco H:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
   4 helices; irregular array, disulfide-linked

4. Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family)

5. Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)

6. Protein Cytochrome c oxidase subunit h [47696] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47697] (9 PDB entries)

8. Domain d1ocoh_: 1oco H: [17804]
   Other proteins in same PDB: d1ocoa_, d1ocob1, d1ocob2, d1ococ_, d1ocod_, d1ocoe_, d1ocof_, d1ocog_, d1ocoi_, d1ocoj_, d1ocok_, d1ocol_, d1ocom_, d1ocon_, d1ocoo1, d1ocoo2, d1ocop_, d1ocoq_, d1ocor_, d1ocos_, d1ocot_, d1ocov_, d1ocow_, d1ocox_, d1ocoy_, d1ocoz_
   complexed with cmo, cu, hea, mg, na, zn

Details for d1ocoh_

PDB Entry: 1oco, 2.8 Å

PDB Description: bovine heart cytochrome c oxidase in carbon monoxide-bound state

PDB Compounds: (H:) cytochrome c oxidase

SCOPe Domain Sequences for d1ocoh_:

Sequence; same for both SEQRES and ATOM records:

>d1ocoh_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs
twddrraegtfpgki

Timeline for d1ocoh_:

• d1ocoh_ first appeared (with stable ids) in SCOP 1.55
  
• d1ocoh_ appears in SCOPe 2.03
  
• d1ocoh_ appears in SCOPe 2.05
  
• d1ocoh_ appears in the current release, SCOPe 2.08