Lineage for d1ocoh_ (1oco H:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153487Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
  4. 153488Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 153489Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (1 protein)
  6. 153490Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 153491Species Cow (Bos taurus) [TaxId:9913] [47697] (5 PDB entries)
  8. 153500Domain d1ocoh_: 1oco H: [17804]
    Other proteins in same PDB: d1ocoa1, d1ocob1, d1ocob2, d1ococ1, d1ocod1, d1ocoe_, d1ocof_, d1ocog1, d1ocoi1, d1ocoj1, d1ocok1, d1ocol1, d1ocom1, d1ocon1, d1ocoo1, d1ocoo2, d1ocop1, d1ocoq1, d1ocor_, d1ocos_, d1ocot1, d1ocov1, d1ocow1, d1ocox1, d1ocoy1, d1ocoz1

Details for d1ocoh_

PDB Entry: 1oco (more details), 2.8 Å

PDB Description: bovine heart cytochrome c oxidase in carbon monoxide-bound state

SCOP Domain Sequences for d1ocoh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocoh_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus)}
yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs
twddrraegtfpgki

SCOP Domain Coordinates for d1ocoh_:

Click to download the PDB-style file with coordinates for d1ocoh_.
(The format of our PDB-style files is described here.)

Timeline for d1ocoh_: