Lineage for d1oczu_ (1ocz U:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 443950Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 443951Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 443952Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (1 protein)
  6. 443953Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 443954Species Cow (Bos taurus) [TaxId:9913] [47697] (7 PDB entries)
  8. 443966Domain d1oczu_: 1ocz U: [17803]
    Other proteins in same PDB: d1ocza_, d1oczb1, d1oczb2, d1oczc_, d1oczd_, d1ocze_, d1oczf_, d1oczg_, d1oczi_, d1oczj_, d1oczk_, d1oczl_, d1oczm_, d1oczn_, d1oczo1, d1oczo2, d1oczp_, d1oczq_, d1oczr_, d1oczs_, d1oczt_, d1oczv_, d1oczw_, d1oczx_, d1oczy_, d1oczz_

Details for d1oczu_

PDB Entry: 1ocz (more details), 2.9 Å

PDB Description: bovine heart cytochrome c oxidase in azide-bound state

SCOP Domain Sequences for d1oczu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oczu_ a.51.1.1 (U:) Cytochrome c oxidase subunit h {Cow (Bos taurus)}
yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs
twddrraegtfpgki

SCOP Domain Coordinates for d1oczu_:

Click to download the PDB-style file with coordinates for d1oczu_.
(The format of our PDB-style files is described here.)

Timeline for d1oczu_: