Lineage for d1oczh_ (1ocz H:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48426Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
  4. 48427Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 48428Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (1 protein)
  6. 48429Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 48430Species Cow (Bos taurus) [TaxId:9913] [47697] (5 PDB entries)
  8. 48437Domain d1oczh_: 1ocz H: [17802]
    Other proteins in same PDB: d1ocza1, d1oczb1, d1oczb2, d1oczc1, d1oczd1, d1ocze_, d1oczf_, d1oczg1, d1oczi1, d1oczj1, d1oczk1, d1oczl1, d1oczm1, d1oczn1, d1oczo1, d1oczo2, d1oczp1, d1oczq1, d1oczr_, d1oczs_, d1oczt1, d1oczv1, d1oczw1, d1oczx1, d1oczy1, d1oczz1

Details for d1oczh_

PDB Entry: 1ocz (more details), 2.9 Å

PDB Description: bovine heart cytochrome c oxidase in azide-bound state

SCOP Domain Sequences for d1oczh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oczh_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus)}
yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs
twddrraegtfpgki

SCOP Domain Coordinates for d1oczh_:

Click to download the PDB-style file with coordinates for d1oczh_.
(The format of our PDB-style files is described here.)

Timeline for d1oczh_: