Lineage for d1occu_ (1occ U:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1492941Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 1492942Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 1492943Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 1492944Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 1492945Species Cow (Bos taurus) [TaxId:9913] [47697] (9 PDB entries)
  8. 1492958Domain d1occu_: 1occ U: [17801]
    Other proteins in same PDB: d1occa_, d1occb1, d1occb2, d1occc_, d1occd_, d1occe_, d1occf_, d1occg_, d1occi_, d1occj_, d1occk_, d1occl_, d1occm_, d1occn_, d1occo1, d1occo2, d1occp_, d1occq_, d1occr_, d1occs_, d1occt_, d1occv_, d1occw_, d1occx_, d1occy_, d1occz_
    complexed with cu, hea, mg, zn

Details for d1occu_

PDB Entry: 1occ (more details), 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state
PDB Compounds: (U:) cytochrome c oxidase

SCOPe Domain Sequences for d1occu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1occu_ a.51.1.1 (U:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs
twddrraegtfpgki

SCOPe Domain Coordinates for d1occu_:

Click to download the PDB-style file with coordinates for d1occu_.
(The format of our PDB-style files is described here.)

Timeline for d1occu_: