Lineage for d1occu_ (1occ U:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 356507Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 356508Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 356509Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (1 protein)
  6. 356510Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 356511Species Cow (Bos taurus) [TaxId:9913] [47697] (7 PDB entries)
  8. 356521Domain d1occu_: 1occ U: [17801]
    Other proteins in same PDB: d1occa_, d1occb1, d1occb2, d1occc_, d1occd_, d1occe_, d1occf_, d1occg_, d1occi_, d1occj_, d1occk_, d1occl_, d1occm_, d1occn_, d1occo1, d1occo2, d1occp_, d1occq_, d1occr_, d1occs_, d1occt_, d1occv_, d1occw_, d1occx_, d1occy_, d1occz_
    complexed with cu, hea, mg, zn

Details for d1occu_

PDB Entry: 1occ (more details), 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d1occu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1occu_ a.51.1.1 (U:) Cytochrome c oxidase subunit h {Cow (Bos taurus)}
yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs
twddrraegtfpgki

SCOP Domain Coordinates for d1occu_:

Click to download the PDB-style file with coordinates for d1occu_.
(The format of our PDB-style files is described here.)

Timeline for d1occu_: