SCOPe 2.07: Domain d1occh_: 1occ H:

Lineage for d1occh_ (1occ H:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
   4 helices; irregular array, disulfide-linked

4. Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families)

5. Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)

6. Protein Cytochrome c oxidase subunit h [47696] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47697] (29 PDB entries)

8. Domain d1occh_: 1occ H: [17800]
   Other proteins in same PDB: d1occa_, d1occb1, d1occb2, d1occc_, d1occd_, d1occe_, d1occf_, d1occg_, d1occi_, d1occj_, d1occk_, d1occl_, d1occm_, d1occn_, d1occo1, d1occo2, d1occp_, d1occq_, d1occr_, d1occs_, d1occt_, d1occv_, d1occw_, d1occx_, d1occy_, d1occz_
   complexed with cu, hea, mg, zn

Details for d1occh_

PDB Entry: 1occ, 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state

PDB Compounds: (H:) cytochrome c oxidase

SCOPe Domain Sequences for d1occh_:

Sequence; same for both SEQRES and ATOM records:

>d1occh_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs
twddrraegtfpgki

Timeline for d1occh_:

• d1occh_ first appeared (with stable ids) in SCOP 1.55
  
• d1occh_ appears in SCOPe 2.06
  
• d1occh_ appears in the current release, SCOPe 2.08