Lineage for d1occh_ (1occ H:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4053Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
  4. 4054Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 4055Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (1 protein)
  6. 4056Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 4057Species Cow (Bos taurus) [TaxId:9913] [47697] (5 PDB entries)
  8. 4062Domain d1occh_: 1occ H: [17800]
    Other proteins in same PDB: d1occa1, d1occb1, d1occb2, d1occc1, d1occd1, d1occe_, d1occf_, d1occg1, d1occi1, d1occj1, d1occk1, d1occl1, d1occm1, d1occn1, d1occo1, d1occo2, d1occp1, d1occq1, d1occr_, d1occs_, d1occt1, d1occv1, d1occw1, d1occx1, d1occy1, d1occz1

Details for d1occh_

PDB Entry: 1occ (more details), 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d1occh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1occh_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus)}
yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs
twddrraegtfpgki

SCOP Domain Coordinates for d1occh_:

Click to download the PDB-style file with coordinates for d1occh_.
(The format of our PDB-style files is described here.)

Timeline for d1occh_: