SCOPe 2.06: Domain d3i07a_: 3i07 A:

Lineage for d3i07a_ (3i07 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.227: OsmC-like [82783] (1 superfamily)
   swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix

4. Superfamily d.227.1: OsmC-like [82784] (3 families)

5. Family d.227.1.0: automated matches [191395] (1 protein)
   not a true family

6. Protein automated matches [190512] (3 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [188637] (3 PDB entries)

8. Domain d3i07a_: 3i07 A: [177995]
   Other proteins in same PDB: d3i07b2
   automated match to d1uspa_
   complexed with gol, mes

Details for d3i07a_

PDB Entry: 3i07, 1.5 Å

PDB Description: Crystal structure of a putative organic hydroperoxide resistance protein from Vibrio cholerae O1 biovar eltor str. N16961

PDB Compounds: (A:) organic hydroperoxide resistance protein

SCOPe Domain Sequences for d3i07a_:

Sequence; same for both SEQRES and ATOM records:

>d3i07a_ d.227.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
mrnknmstiyqtsatasagrngvvstedkllelnlsypkemggsgtatnpeqlfavgyaa
cfsnailhvareakvalkeapvtatvgigpngqggfalsvalaahialedeqarqlvtva
hqvcpysnavrgnidvqvsvnglal

Timeline for d3i07a_:

• d3i07a_ first appeared in SCOPe 2.01
  
• d3i07a_ appears in SCOPe 2.05
  
• d3i07a_ appears in SCOPe 2.07
  
• d3i07a_ appears in the current release, SCOPe 2.08