Lineage for d3i07a_ (3i07 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1051525Fold d.227: OsmC-like [82783] (1 superfamily)
    swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix
  4. 1051526Superfamily d.227.1: OsmC-like [82784] (3 families) (S)
  5. 1051592Family d.227.1.0: automated matches [191395] (1 protein)
    not a true family
  6. 1051593Protein automated matches [190512] (2 species)
    not a true protein
  7. 1051597Species Vibrio cholerae [TaxId:243277] [188637] (3 PDB entries)
  8. 1051599Domain d3i07a_: 3i07 A: [177995]
    automated match to d1uspa_
    complexed with gol, mes

Details for d3i07a_

PDB Entry: 3i07 (more details), 1.5 Å

PDB Description: Crystal structure of a putative organic hydroperoxide resistance protein from Vibrio cholerae O1 biovar eltor str. N16961
PDB Compounds: (A:) organic hydroperoxide resistance protein

SCOPe Domain Sequences for d3i07a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i07a_ d.227.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
mrnknmstiyqtsatasagrngvvstedkllelnlsypkemggsgtatnpeqlfavgyaa
cfsnailhvareakvalkeapvtatvgigpngqggfalsvalaahialedeqarqlvtva
hqvcpysnavrgnidvqvsvnglal

SCOPe Domain Coordinates for d3i07a_:

Click to download the PDB-style file with coordinates for d3i07a_.
(The format of our PDB-style files is described here.)

Timeline for d3i07a_: