Lineage for d1ocru_ (1ocr U:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153487Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
  4. 153488Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 153489Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (1 protein)
  6. 153490Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 153491Species Cow (Bos taurus) [TaxId:9913] [47697] (5 PDB entries)
  8. 153493Domain d1ocru_: 1ocr U: [17799]
    Other proteins in same PDB: d1ocra1, d1ocrb1, d1ocrb2, d1ocrc1, d1ocrd1, d1ocre_, d1ocrf_, d1ocrg1, d1ocri1, d1ocrj1, d1ocrk1, d1ocrl1, d1ocrm1, d1ocrn1, d1ocro1, d1ocro2, d1ocrp1, d1ocrq1, d1ocrr_, d1ocrs_, d1ocrt1, d1ocrv1, d1ocrw1, d1ocrx1, d1ocry1, d1ocrz1

Details for d1ocru_

PDB Entry: 1ocr (more details), 2.35 Å

PDB Description: bovine heart cytochrome c oxidase in the fully reduced state

SCOP Domain Sequences for d1ocru_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocru_ a.51.1.1 (U:) Cytochrome c oxidase subunit h {Cow (Bos taurus)}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOP Domain Coordinates for d1ocru_:

Click to download the PDB-style file with coordinates for d1ocru_.
(The format of our PDB-style files is described here.)

Timeline for d1ocru_: