Lineage for d1ocrh_ (1ocr H:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 282016Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulphide-linked
  4. 282017Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 282018Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (1 protein)
  6. 282019Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 282020Species Cow (Bos taurus) [TaxId:9913] [47697] (5 PDB entries)
  8. 282021Domain d1ocrh_: 1ocr H: [17798]
    Other proteins in same PDB: d1ocra_, d1ocrb1, d1ocrb2, d1ocrc_, d1ocrd_, d1ocre_, d1ocrf_, d1ocrg_, d1ocri_, d1ocrj_, d1ocrk_, d1ocrl_, d1ocrm_, d1ocrn_, d1ocro1, d1ocro2, d1ocrp_, d1ocrq_, d1ocrr_, d1ocrs_, d1ocrt_, d1ocrv_, d1ocrw_, d1ocrx_, d1ocry_, d1ocrz_

Details for d1ocrh_

PDB Entry: 1ocr (more details), 2.35 Å

PDB Description: bovine heart cytochrome c oxidase in the fully reduced state

SCOP Domain Sequences for d1ocrh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocrh_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus)}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOP Domain Coordinates for d1ocrh_:

Click to download the PDB-style file with coordinates for d1ocrh_.
(The format of our PDB-style files is described here.)

Timeline for d1ocrh_: