| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
| Family d.2.1.0: automated matches [191411] (1 protein) not a true family |
| Protein automated matches [190563] (6 species) not a true protein |
| Species Staphylococcus aureus [TaxId:196620] [188997] (1 PDB entry) |
| Domain d3hzsa_: 3hzs A: [177971] automated match to d2oqoa1 complexed with m0e, po4 |
PDB Entry: 3hzs (more details), 2.1 Å
SCOPe Domain Sequences for d3hzsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hzsa_ d.2.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 196620]}
nlyfqghmdnvdelrkienkssfvsadnmpeyvkgafismqderfynhhgfdlkgttral
fstisdrdvqggstitqqvvknyfydndrsftrkvkelfvahrvekqynkneilsfylnn
iyfgdnqytlegaanhyfgttvnknsttmshitvlqsailaskvnapsvyninnmsenft
qrvstnlekmkqqnyinetqyqqamsqln
Timeline for d3hzsa_: