Lineage for d3hzsa_ (3hzs A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1013435Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1013436Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1014821Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 1014822Protein automated matches [190563] (6 species)
    not a true protein
  7. 1014839Species Staphylococcus aureus [TaxId:196620] [188997] (1 PDB entry)
  8. 1014840Domain d3hzsa_: 3hzs A: [177971]
    automated match to d2oqoa1
    complexed with m0e, po4

Details for d3hzsa_

PDB Entry: 3hzs (more details), 2.1 Å

PDB Description: s. aureus monofunctional glycosyltransferase (mtga)in complex with moenomycin
PDB Compounds: (A:) Monofunctional glycosyltransferase

SCOPe Domain Sequences for d3hzsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hzsa_ d.2.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 196620]}
nlyfqghmdnvdelrkienkssfvsadnmpeyvkgafismqderfynhhgfdlkgttral
fstisdrdvqggstitqqvvknyfydndrsftrkvkelfvahrvekqynkneilsfylnn
iyfgdnqytlegaanhyfgttvnknsttmshitvlqsailaskvnapsvyninnmsenft
qrvstnlekmkqqnyinetqyqqamsqln

SCOPe Domain Coordinates for d3hzsa_:

Click to download the PDB-style file with coordinates for d3hzsa_.
(The format of our PDB-style files is described here.)

Timeline for d3hzsa_: