SCOPe 2.01: Domain d3hzsa_: 3hzs A:

Lineage for d3hzsa_ (3hzs A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.0: automated matches [191411] (1 protein)
   not a true family

6. Protein automated matches [190563] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:196620] [188997] (1 PDB entry)

8. Domain d3hzsa_: 3hzs A: [177971]
   automated match to d2oqoa1
   complexed with m0e, po4

Details for d3hzsa_

PDB Entry: 3hzs, 2.1 Å

PDB Description: s. aureus monofunctional glycosyltransferase (mtga)in complex with moenomycin

PDB Compounds: (A:) Monofunctional glycosyltransferase

SCOPe Domain Sequences for d3hzsa_:

Sequence; same for both SEQRES and ATOM records:

>d3hzsa_ d.2.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 196620]}
nlyfqghmdnvdelrkienkssfvsadnmpeyvkgafismqderfynhhgfdlkgttral
fstisdrdvqggstitqqvvknyfydndrsftrkvkelfvahrvekqynkneilsfylnn
iyfgdnqytlegaanhyfgttvnknsttmshitvlqsailaskvnapsvyninnmsenft
qrvstnlekmkqqnyinetqyqqamsqln

Timeline for d3hzsa_:

• d3hzsa_ is new in SCOPe 2.01-stable
  
• d3hzsa_ appears in SCOPe 2.02
  
• d3hzsa_ appears in the current release, SCOPe 2.08, called d3hzsa1