SCOPe 2.07: Domain d2occu_: 2occ U:

Lineage for d2occu_ (2occ U:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
   4 helices; irregular array, disulfide-linked

4. Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families)

5. Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)

6. Protein Cytochrome c oxidase subunit h [47696] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47697] (29 PDB entries)

8. Domain d2occu_: 2occ U: [17797]
   Other proteins in same PDB: d2occa_, d2occb1, d2occb2, d2occc_, d2occd_, d2occe_, d2occf_, d2occg_, d2occi_, d2occj_, d2occk_, d2occl_, d2occm_, d2occn_, d2occo1, d2occo2, d2occp_, d2occq_, d2occr_, d2occs_, d2occt_, d2occv_, d2occw_, d2occx_, d2occy_, d2occz_
   complexed with cu, hea, mg, na, per, zn

Details for d2occu_

PDB Entry: 2occ, 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state

PDB Compounds: (U:) cytochrome c oxidase

SCOPe Domain Sequences for d2occu_:

Sequence; same for both SEQRES and ATOM records:

>d2occu_ a.51.1.1 (U:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

Timeline for d2occu_:

• d2occu_ first appeared (with stable ids) in SCOP 1.55
  
• d2occu_ appears in SCOPe 2.06
  
• d2occu_ appears in the current release, SCOPe 2.08