Lineage for d2occu_ (2occ U:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153487Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
  4. 153488Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 153489Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (1 protein)
  6. 153490Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 153491Species Cow (Bos taurus) [TaxId:9913] [47697] (5 PDB entries)
  8. 153495Domain d2occu_: 2occ U: [17797]
    Other proteins in same PDB: d2occa1, d2occb1, d2occb2, d2occc1, d2occd1, d2occe_, d2occf_, d2occg1, d2occi1, d2occj1, d2occk1, d2occl1, d2occm1, d2occn1, d2occo1, d2occo2, d2occp1, d2occq1, d2occr_, d2occs_, d2occt1, d2occv1, d2occw1, d2occx1, d2occy1, d2occz1

Details for d2occu_

PDB Entry: 2occ (more details), 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d2occu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2occu_ a.51.1.1 (U:) Cytochrome c oxidase subunit h {Cow (Bos taurus)}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOP Domain Coordinates for d2occu_:

Click to download the PDB-style file with coordinates for d2occu_.
(The format of our PDB-style files is described here.)

Timeline for d2occu_: