Lineage for d2occh_ (2occ H:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770504Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 770505Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 770506Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (1 protein)
  6. 770507Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 770508Species Cow (Bos taurus) [TaxId:9913] [47697] (14 PDB entries)
  8. 770523Domain d2occh_: 2occ H: [17796]
    Other proteins in same PDB: d2occa_, d2occb1, d2occb2, d2occc_, d2occd_, d2occe_, d2occf_, d2occg_, d2occi_, d2occj_, d2occk_, d2occl_, d2occm_, d2occn_, d2occo1, d2occo2, d2occp_, d2occq_, d2occr_, d2occs_, d2occt_, d2occv_, d2occw_, d2occx_, d2occy_, d2occz_

Details for d2occh_

PDB Entry: 2occ (more details), 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state
PDB Compounds: (H:) cytochrome c oxidase

SCOP Domain Sequences for d2occh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2occh_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOP Domain Coordinates for d2occh_:

Click to download the PDB-style file with coordinates for d2occh_.
(The format of our PDB-style files is described here.)

Timeline for d2occh_: