Lineage for d0c3a__ (0c3a -)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153475Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily)
  4. 153476Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) (S)
  5. 153477Family a.50.1.1: Anaphylotoxins (complement system) [47687] (2 proteins)
  6. Protein C3a anaphylotoxin [47691] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [47692] (1 PDB entry)
  8. Domain d0c3a__: 0c3a - [17795]

Details for d0c3a__

PDB Entry: 0c3a (more details)

PDB Description: complement protein

SCOP Domain Sequences for d0c3a__:

Sequence, based on SEQRES records: (download)

>d0c3a__ a.50.1.1 (-) C3a anaphylotoxin {Human (Homo sapiens)}
svqltekrmnkvgkypkelrkccedgmrqnpmrfscqrrtrfislgeackkvfldccnyi
telrrqharashlglar

SCOP Domain Coordinates for d0c3a__:

Click to download the PDB-style file with coordinates for d0c3a__.
(The format of our PDB-style files is described here.)

Timeline for d0c3a__: