![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
![]() | Protein automated matches [190805] (8 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188286] (15 PDB entries) |
![]() | Domain d3hygb_: 3hyg B: [177944] automated match to d1r54a_ complexed with 099, ca, zn |
PDB Entry: 3hyg (more details), 1.4 Å
SCOPe Domain Sequences for d3hygb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hygb_ d.92.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} srarqvelllvadasmarkygrglqhylltlasianrlyshasienhirlavvkvvvlgd kdkslevsknaattlknfckwqhqhnqlgddheehydaailftredlcghhscdtlgmad vgticsperscavieddglhaaftvaheighllglshddskfceetfgstedkrlmssil tsidaskpwskctsatiteflddghgnclldlprkqi
Timeline for d3hygb_: