Lineage for d3hygb_ (3hyg B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1211973Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1211974Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1212831Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 1212832Protein automated matches [190805] (5 species)
    not a true protein
  7. 1212838Species Human (Homo sapiens) [TaxId:9606] [188286] (12 PDB entries)
  8. 1212843Domain d3hygb_: 3hyg B: [177944]
    automated match to d1r54a_
    complexed with 099, ca, zn

Details for d3hygb_

PDB Entry: 3hyg (more details), 1.4 Å

PDB Description: crystal structure of the catalytic domain of adamts-5 in complex with an amino-2-indanol compound
PDB Compounds: (B:) A disintegrin and metalloproteinase with thrombospondin motifs 5

SCOPe Domain Sequences for d3hygb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hygb_ d.92.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srarqvelllvadasmarkygrglqhylltlasianrlyshasienhirlavvkvvvlgd
kdkslevsknaattlknfckwqhqhnqlgddheehydaailftredlcghhscdtlgmad
vgticsperscavieddglhaaftvaheighllglshddskfceetfgstedkrlmssil
tsidaskpwskctsatiteflddghgnclldlprkqi

SCOPe Domain Coordinates for d3hygb_:

Click to download the PDB-style file with coordinates for d3hygb_.
(The format of our PDB-style files is described here.)

Timeline for d3hygb_: