Lineage for d3hyeq_ (3hye Q:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2224887Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2224903Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (193 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2224967Domain d3hyeq_: 3hye Q: [177933]
    Other proteins in same PDB: d3hye1_, d3hye2_, d3hyed_, d3hyeg_, d3hyeh_, d3hyei_, d3hyej_, d3hyek_, d3hyel_, d3hyem_, d3hyen_, d3hyer_, d3hyeu_, d3hyev_, d3hyew_, d3hyex_, d3hyey_, d3hyez_
    automated match to d1g65c_
    complexed with hye

Details for d3hyeq_

PDB Entry: 3hye (more details), 2.5 Å

PDB Description: Crystal structure of 20S proteasome in complex with hydroxylated salinosporamide
PDB Compounds: (Q:) Proteasome component PRE6

SCOPe Domain Sequences for d3hyeq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hyeq_ d.153.1.4 (Q:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
q

SCOPe Domain Coordinates for d3hyeq_:

Click to download the PDB-style file with coordinates for d3hyeq_.
(The format of our PDB-style files is described here.)

Timeline for d3hyeq_: