Lineage for d3hyem_ (3hye M:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2550690Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2550699Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (199 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2550789Domain d3hyem_: 3hye M: [177929]
    Other proteins in same PDB: d3hyea_, d3hyeb_, d3hyec_, d3hyee_, d3hyef_, d3hyeg_, d3hyeo_, d3hyep_, d3hyeq_, d3hyes_, d3hyet_, d3hyeu_
    automated match to d1g0u1_
    complexed with hye

Details for d3hyem_

PDB Entry: 3hye (more details), 2.5 Å

PDB Description: Crystal structure of 20S proteasome in complex with hydroxylated salinosporamide
PDB Compounds: (M:) Proteasome component PRE4

SCOPe Domain Sequences for d3hyem_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hyem_ d.153.1.4 (M:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d3hyem_:

Click to download the PDB-style file with coordinates for d3hyem_.
(The format of our PDB-style files is described here.)

Timeline for d3hyem_: