Lineage for d3hyeg_ (3hye G:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1936395Protein automated matches [190144] (7 species)
    not a true protein
  7. 1936416Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (39 PDB entries)
  8. 1936464Domain d3hyeg_: 3hye G: [177923]
    Other proteins in same PDB: d3hye1_, d3hye2_, d3hyea_, d3hyeb_, d3hyec_, d3hyed_, d3hyee_, d3hyef_, d3hyeh_, d3hyei_, d3hyej_, d3hyek_, d3hyel_, d3hyem_, d3hyen_, d3hyeo_, d3hyep_, d3hyeq_, d3hyer_, d3hyes_, d3hyet_, d3hyev_, d3hyew_, d3hyex_, d3hyey_, d3hyez_
    automated match to d1g65g_
    complexed with hye

Details for d3hyeg_

PDB Entry: 3hye (more details), 2.5 Å

PDB Description: Crystal structure of 20S proteasome in complex with hydroxylated salinosporamide
PDB Compounds: (G:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3hyeg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hyeg_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d3hyeg_:

Click to download the PDB-style file with coordinates for d3hyeg_.
(The format of our PDB-style files is described here.)

Timeline for d3hyeg_: