Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (7 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (39 PDB entries) |
Domain d3hyeg_: 3hye G: [177923] Other proteins in same PDB: d3hye1_, d3hye2_, d3hyea_, d3hyeb_, d3hyec_, d3hyed_, d3hyee_, d3hyef_, d3hyeh_, d3hyei_, d3hyej_, d3hyek_, d3hyel_, d3hyem_, d3hyen_, d3hyeo_, d3hyep_, d3hyeq_, d3hyer_, d3hyes_, d3hyet_, d3hyev_, d3hyew_, d3hyex_, d3hyey_, d3hyez_ automated match to d1g65g_ complexed with hye |
PDB Entry: 3hye (more details), 2.5 Å
SCOPe Domain Sequences for d3hyeg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hyeg_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia eqd
Timeline for d3hyeg_:
View in 3D Domains from other chains: (mouse over for more information) d3hye1_, d3hye2_, d3hyea_, d3hyeb_, d3hyec_, d3hyed_, d3hyee_, d3hyef_, d3hyeh_, d3hyei_, d3hyej_, d3hyek_, d3hyel_, d3hyem_, d3hyen_, d3hyeo_, d3hyep_, d3hyeq_, d3hyer_, d3hyes_, d3hyet_, d3hyeu_, d3hyev_, d3hyew_, d3hyex_, d3hyey_, d3hyez_ |