SCOPe 2.07: Domain d3hy7a_: 3hy7 A:

Lineage for d3hy7a_ (3hy7 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.0: automated matches [191495] (1 protein)
   not a true family

6. Protein automated matches [190805] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188286] (68 PDB entries)

8. Domain d3hy7a_: 3hy7 A: [177913]
   automated match to d1r54a_
   complexed with 097, ca, zn

Details for d3hy7a_

PDB Entry: 3hy7, 1.69 Å

PDB Description: crystal structure of the catalytic domain of adamts-5 in complex with marimastat

PDB Compounds: (A:) A disintegrin and metalloproteinase with thrombospondin motifs 5

SCOPe Domain Sequences for d3hy7a_:

Sequence; same for both SEQRES and ATOM records:

>d3hy7a_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srarqvelllvadasmarkygrglqhylltlasianrlyshasienhirlavvkvvvlgd
kdkslevsknaattlknfckwqhqhnqlgddheehydaailftredlcghhscdtlgmad
vgticsperscavieddglhaaftvaheighllglshddskfceetfgstedkrlmssil
tsidaskpwskctsatiteflddghgnclldlprkqi

Timeline for d3hy7a_:

• d3hy7a_ first appeared in SCOPe 2.01
  
• d3hy7a_ appears in SCOPe 2.06
  
• d3hy7a_ appears in the current release, SCOPe 2.08