SCOPe 2.01: Domain d3hxqa_: 3hxq A:

Lineage for d3hxqa_ (3hxq A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)

6. Protein automated matches [190060] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186779] (6 PDB entries)

8. Domain d3hxqa_: 3hxq A: [177910]
   automated match to d1auqa_
   protein/DNA complex

Details for d3hxqa_

PDB Entry: 3hxq, 2.69 Å

PDB Description: crystal structure of von willebrand factor (vwf) a1 domain in complex with dna aptamer arc1172, an inhibitor of vwf-platelet binding

PDB Compounds: (A:) von willebrand factor

SCOPe Domain Sequences for d3hxqa_:

Sequence; same for both SEQRES and ATOM records:

>d3hxqa_ c.62.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pplhdfycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhdg
shayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialll
masqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvd
eleqqrdeivsylcdlapeap

Timeline for d3hxqa_:

• d3hxqa_ is new in SCOPe 2.01-stable
  
• d3hxqa_ appears in SCOPe 2.02
  
• d3hxqa_ appears in the current release, SCOPe 2.08