Lineage for d3hupb_ (3hup B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2234639Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2235083Protein automated matches [190329] (9 species)
    not a true protein
  7. 2235107Species Human (Homo sapiens) [TaxId:9606] [187151] (9 PDB entries)
  8. 2235109Domain d3hupb_: 3hup B: [177851]
    automated match to d1fm5a_
    complexed with cl, na

Details for d3hupb_

PDB Entry: 3hup (more details), 1.37 Å

PDB Description: High-resolution structure of the extracellular domain of human CD69
PDB Compounds: (B:) early activation antigen cd69

SCOPe Domain Sequences for d3hupb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hupb_ d.169.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryagreeh
wvglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkpyk

SCOPe Domain Coordinates for d3hupb_:

Click to download the PDB-style file with coordinates for d3hupb_.
(The format of our PDB-style files is described here.)

Timeline for d3hupb_: