SCOPe 2.04: Domain d3huob_: 3huo B:

Lineage for d3huob_ (3huo B:)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (19 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (41 PDB entries)

8. Domain d3huob_: 3huo B: [177849]
   automated match to d1iysa_
   complexed with pnk, pnn

Details for d3huob_

PDB Entry: 3huo, 1.5 Å

PDB Description: x-ray crystallographic structure of ctx-m-9 s70g in complex with benzylpenicillin

PDB Compounds: (B:) CTX-M-9 extended-spectrum beta-lactamase

SCOPe Domain Sequences for d3huob_:

Sequence; same for both SEQRES and ATOM records:

>d3huob_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
avqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqsetqk
qllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpggv
tafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraqlv
twlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftqpqq
naesrrdvlasaariiaegl

Timeline for d3huob_:

• d3huob_ first appeared in SCOPe 2.01
  
• d3huob_ appears in SCOPe 2.03
  
• d3huob_ appears in SCOPe 2.05
  
• d3huob_ appears in the current release, SCOPe 2.08