SCOPe 2.04: Domain d3hu7a_: 3hu7 A:

Lineage for d3hu7a_ (3hu7 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (60 species)
   not a true protein

7. Species Scadoxus multiflorus [TaxId:82246] [188826] (7 PDB entries)

8. Domain d3hu7a_: 3hu7 A: [177839]
   automated match to d1hvqa_
   complexed with act, po4

Details for d3hu7a_

PDB Entry: 3hu7, 2 Å

PDB Description: Structural characterization and binding studies of a plant pathogenesis related protein heamanthin from haemanthus multiflorus reveal its dual inhibitory effects against xylanase and alpha-amylase

PDB Compounds: (A:) Haementhin

SCOPe Domain Sequences for d3hu7a_:

Sequence; same for both SEQRES and ATOM records:

>d3hu7a_ c.1.8.0 (A:) automated matches {Scadoxus multiflorus [TaxId: 82246]}
anldiavywgqnfdersleatcdtgnyayviigflntfgggqtpaldisghspsglepqi
khcqsknvkvllsiggpkgpysldsrsdandlavylfnnfllppghsenrpfgnavldgi
dfhiehggpsqyqllanilssfrlagtefaltaapqcvypdpnlgtvinsatfdaiwvqf
ynnpqcsyssgnaealmnawrewsmkartkkvflgfpahpdaagsgymppekvkfhvfpa
akksykfggimlwdsywdtvsnfsskilgegw

Timeline for d3hu7a_:

• d3hu7a_ first appeared in SCOPe 2.01
  
• d3hu7a_ appears in SCOPe 2.03
  
• d3hu7a_ appears in SCOPe 2.05
  
• d3hu7a_ appears in the current release, SCOPe 2.08