Lineage for d1de4c1 (1de4 C:609-756)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642397Fold a.48: N-cbl like [47667] (4 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 642408Superfamily a.48.2: Transferrin receptor-like dimerisation domain [47672] (1 family) (S)
  5. 642409Family a.48.2.1: Transferrin receptor-like dimerisation domain [47673] (2 proteins)
  6. 642426Protein Transferrin receptor ectodomain, C-terminal domain [47674] (1 species)
  7. 642427Species Human (Homo sapiens) [TaxId:9606] [47675] (3 PDB entries)
  8. 642428Domain d1de4c1: 1de4 C:609-756 [17779]
    Other proteins in same PDB: d1de4a1, d1de4a2, d1de4b_, d1de4c2, d1de4c3, d1de4d1, d1de4d2, d1de4e_, d1de4f2, d1de4f3, d1de4g1, d1de4g2, d1de4h_, d1de4i2, d1de4i3

Details for d1de4c1

PDB Entry: 1de4 (more details), 2.8 Å

PDB Description: hemochromatosis protein hfe complexed with transferrin receptor
PDB Compounds: (C:) transferrin receptor

SCOP Domain Sequences for d1de4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1de4c1 a.48.2.1 (C:609-756) Transferrin receptor ectodomain, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ldyerynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfgnaektdr
fvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkqnngafne
tlfrnqlalatwtiqgaanalsgdvwdi

SCOP Domain Coordinates for d1de4c1:

Click to download the PDB-style file with coordinates for d1de4c1.
(The format of our PDB-style files is described here.)

Timeline for d1de4c1: