Lineage for d1de4c1 (1de4 C:609-756)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153439Fold a.48: N-cbl like [47667] (3 superfamilies)
  4. 153449Superfamily a.48.2: Transferrin receptor ectodomain, C-terminal domain [47672] (1 family) (S)
  5. 153450Family a.48.2.1: Transferrin receptor ectodomain, C-terminal domain [47673] (1 protein)
  6. 153451Protein Transferrin receptor ectodomain, C-terminal domain [47674] (1 species)
  7. 153452Species Human (Homo sapiens) [TaxId:9606] [47675] (2 PDB entries)
  8. 153453Domain d1de4c1: 1de4 C:609-756 [17779]
    Other proteins in same PDB: d1de4a1, d1de4a2, d1de4b1, d1de4c2, d1de4c3, d1de4d1, d1de4d2, d1de4e1, d1de4f2, d1de4f3, d1de4g1, d1de4g2, d1de4h1, d1de4i2, d1de4i3

Details for d1de4c1

PDB Entry: 1de4 (more details), 2.8 Å

PDB Description: hemochromatosis protein hfe complexed with transferrin receptor

SCOP Domain Sequences for d1de4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1de4c1 a.48.2.1 (C:609-756) Transferrin receptor ectodomain, C-terminal domain {Human (Homo sapiens)}
ldyerynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfgnaektdr
fvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkqnngafne
tlfrnqlalatwtiqgaanalsgdvwdi

SCOP Domain Coordinates for d1de4c1:

Click to download the PDB-style file with coordinates for d1de4c1.
(The format of our PDB-style files is described here.)

Timeline for d1de4c1: