Lineage for d1fbva2 (1fbv A:47-177)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 916336Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 916337Superfamily a.48.1: N-terminal domain of cbl (N-cbl) [47668] (1 family) (S)
  5. 916338Family a.48.1.1: N-terminal domain of cbl (N-cbl) [47669] (1 protein)
  6. 916339Protein N-terminal domain of cbl (N-cbl) [47670] (1 species)
  7. 916340Species Human (Homo sapiens) [TaxId:9606] [47671] (9 PDB entries)
  8. 916354Domain d1fbva2: 1fbv A:47-177 [17778]
    Other proteins in same PDB: d1fbva1, d1fbva3, d1fbva4, d1fbvc_
    complexed with so4, zn

Details for d1fbva2

PDB Entry: 1fbv (more details), 2.9 Å

PDB Description: structure of a cbl-ubch7 complex: ring domain function in ubiquitin- protein ligases
PDB Compounds: (A:) signal transduction protein cbl

SCOPe Domain Sequences for d1fbva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbva2 a.48.1.1 (A:47-177) N-terminal domain of cbl (N-cbl) {Human (Homo sapiens) [TaxId: 9606]}
ppgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkm
etlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelk
gifpsglfqgd

SCOPe Domain Coordinates for d1fbva2:

Click to download the PDB-style file with coordinates for d1fbva2.
(The format of our PDB-style files is described here.)

Timeline for d1fbva2: