Lineage for d1fbva2 (1fbv A:47-177)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.48: N-cbl like [47667] (3 superfamilies) Superfamily a.48.1: N-terminal domain of cbl (N-cbl) [47668] (1 family) 
Family a.48.1.1: N-terminal domain of cbl (N-cbl) [47669] (1 protein) Protein N-terminal domain of cbl (N-cbl) [47670] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47671] (3 PDB entries) 
Domain d1fbva2: 1fbv A:47-177 [17778]
Other proteins in same PDB: d1fbva1, d1fbva3, d1fbva4, d1fbvc_
Details for d1fbva2
PDB Entry: 1fbv (more details), 2.9 Å
PDB Description: structure of a cbl-ubch7 complex: ring domain function in ubiquitin- protein ligases
SCOP Domain Sequences for d1fbva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fbva2 a.48.1.1 (A:47-177) N-terminal domain of cbl (N-cbl) {Human (Homo sapiens)}
ppgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkm
etlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelk
gifpsglfqgd
SCOP Domain Coordinates for d1fbva2:
Click to download the PDB-style file with coordinates for d1fbva2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fbva2:
- d1fbva2 appears in SCOP 1.57
- d1fbva2 appears in the current release, SCOPe 2.08
View in 3D
