Lineage for d3hq2a_ (3hq2 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530184Species Bacillus subtilis [TaxId:1423] [188945] (1 PDB entry)
  8. 2530185Domain d3hq2a_: 3hq2 A: [177770]
    automated match to d1k9xa_
    complexed with cl, f, po4, zn

Details for d3hq2a_

PDB Entry: 3hq2 (more details), 2.9 Å

PDB Description: BsuCP Crystal Structure
PDB Compounds: (A:) Bacillus subtilis M32 carboxypeptidase

SCOPe Domain Sequences for d3hq2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hq2a_ d.92.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
tyekeffdllkrishyseavalmhwdsrtgapkngsedraesigqlstdifniqtsdrmk
elidvlyerfddlsedtkkavelakkeyeenkkipeaeykeyvilcskaetaweeakgks
dfslfspyleqliefnkrfitywgyqehpydalldlfepgvtvkvldqlfaelkeaiipl
vkqvtasgnkpdtsfitkafpkekqkelslyflqelgydfdggrldetvhpfattlnrgd
vrvttrydekdfrtaifgtihecghaiyeqnidealsgtnlsdgasmgihesqslfyenf
igrnkhfwtpyykkiqeaspvqfkdislddfvraineskpsfirveadeltyplhiiiry
eiekaifsnevsvedlpslwnqkyqdylgitpqtdaegilqdvhwaggdfgyfpsyalgy
myaaqlkqkmledlpefdallergefhpikqwltekvhihgkrkkpldiikdatgeelnv
rylidylsnkysnlyl

SCOPe Domain Coordinates for d3hq2a_:

Click to download the PDB-style file with coordinates for d3hq2a_.
(The format of our PDB-style files is described here.)

Timeline for d3hq2a_: