Lineage for d1b47c2 (1b47 C:47-177)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1736945Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 1736946Superfamily a.48.1: N-terminal domain of cbl (N-cbl) [47668] (2 families) (S)
    automatically mapped to Pfam PF02262
  5. 1736947Family a.48.1.1: N-terminal domain of cbl (N-cbl) [47669] (1 protein)
  6. 1736948Protein N-terminal domain of cbl (N-cbl) [47670] (1 species)
  7. 1736949Species Human (Homo sapiens) [TaxId:9606] [47671] (10 PDB entries)
  8. 1736960Domain d1b47c2: 1b47 C:47-177 [17777]
    Other proteins in same PDB: d1b47a1, d1b47a3, d1b47b1, d1b47b3, d1b47c1, d1b47c3
    complexed with ca

Details for d1b47c2

PDB Entry: 1b47 (more details), 2.2 Å

PDB Description: structure of the n-terminal domain of cbl in complex with its binding site in zap-70
PDB Compounds: (C:) cbl

SCOPe Domain Sequences for d1b47c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b47c2 a.48.1.1 (C:47-177) N-terminal domain of cbl (N-cbl) {Human (Homo sapiens) [TaxId: 9606]}
ppgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkm
etlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelk
gifpsglfqgd

SCOPe Domain Coordinates for d1b47c2:

Click to download the PDB-style file with coordinates for d1b47c2.
(The format of our PDB-style files is described here.)

Timeline for d1b47c2: