SCOPe 2.03: Domain d3hpnf_: 3hpn F:

Lineage for d3hpnf_ (3hpn F:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188939] (7 PDB entries)

8. Domain d3hpnf_: 3hpn F: [177767]
   automated match to d1kgya_

Details for d3hpnf_

PDB Entry: 3hpn, 2.52 Å

PDB Description: ligand recognition by a-class eph receptors: crystal structures of the epha2 ligand-binding domain and the epha2/ephrin-a1 complex

PDB Compounds: (F:) Ephrin type-A receptor 2

SCOPe Domain Sequences for d3hpnf_:

Sequence; same for both SEQRES and ATOM records:

>d3hpnf_ b.18.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvlldfaaaggelgwlthpygkgwdlmqnimndmpiymysvcnvmsgdqdnwlrtnwvy
rgeaerifielkftvrdcnsfpggasscketfnlyyaesdldygtnfqkrlftkidtiap
deitvssdfearhvklnveersvgpltrkgfylafqdigacvallsvrvyykkc

Timeline for d3hpnf_:

• d3hpnf_ first appeared in SCOPe 2.01
  
• d3hpnf_ appears in SCOPe 2.02
  
• d3hpnf_ appears in SCOPe 2.04
  
• d3hpnf_ appears in the current release, SCOPe 2.08