Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (14 species) not a true protein |
Species Thermus thermophilus [TaxId:262724] [188942] (1 PDB entry) |
Domain d3hoab_: 3hoa B: [177726] automated match to d1k9xa_ complexed with gol |
PDB Entry: 3hoa (more details), 2.1 Å
SCOPe Domain Sequences for d3hoab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hoab_ d.92.1.0 (B:) automated matches {Thermus thermophilus [TaxId: 262724]} mtpeaayqnllefqretaylaslgalaawdqrtmipkkghehrarqmaalarllhqrmtd prigewlekvegsplvqdplsdaavnvrewrqayeraraiperlavelaqaeseaesfwe earprddwrgflpylkrvyaltkekaevlfalppapgdppygelydalldgyepgmrare llplfaelkeglkglldrilgsgkrpdtsilhrpypveaqrrfalellsacgydleagrl dptahpfeiaigpgdvrittryyedffnagifgtlhemghalyeqglpkehwgtprgdav slgvhesqsrtwenlvgrslgfwerffprarevfaslgdvsledfhfavnavepslirve adevtynlhilvrlelelalfrgelspedlpeawaekyrdhlgvapkdykdgvmqdvhwa gglfgyfptytlgnlyaaqffqkaeaelgpleprfargefqpfldwtrarihaegsrfrp rvlvervtgeapsarpflaylekkyaaly
Timeline for d3hoab_: