Lineage for d3hoaa_ (3hoa A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530334Species Thermus thermophilus [TaxId:262724] [188942] (1 PDB entry)
  8. 2530335Domain d3hoaa_: 3hoa A: [177725]
    automated match to d1k9xa_
    complexed with gol

Details for d3hoaa_

PDB Entry: 3hoa (more details), 2.1 Å

PDB Description: Crystal structure of the Thermus thermophilus M32 carboxypeptidase
PDB Compounds: (A:) Thermostable carboxypeptidase 1

SCOPe Domain Sequences for d3hoaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hoaa_ d.92.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 262724]}
mtpeaayqnllefqretaylaslgalaawdqrtmipkkghehrarqmaalarllhqrmtd
prigewlekvegsplvqdplsdaavnvrewrqayeraraiperlavelaqaeseaesfwe
earprddwrgflpylkrvyaltkekaevlfalppapgdppygelydalldgyepgmrare
llplfaelkeglkglldrilgsgkrpdtsilhrpypveaqrrfalellsacgydleagrl
dptahpfeiaigpgdvrittryyedffnagifgtlhemghalyeqglpkehwgtprgdav
slgvhesqsrtwenlvgrslgfwerffprarevfaslgdvsledfhfavnavepslirve
adevtynlhilvrlelelalfrgelspedlpeawaekyrdhlgvapkdykdgvmqdvhwa
gglfgyfptytlgnlyaaqffqkaeaelgpleprfargefqpfldwtrarihaegsrfrp
rvlvervtgeapsarpflaylekkyaaly

SCOPe Domain Coordinates for d3hoaa_:

Click to download the PDB-style file with coordinates for d3hoaa_.
(The format of our PDB-style files is described here.)

Timeline for d3hoaa_: