Lineage for d3hmca_ (3hmc A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1820295Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1820296Protein automated matches [190075] (72 species)
    not a true protein
  7. 1820306Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [189358] (1 PDB entry)
  8. 1820307Domain d3hmca_: 3hmc A: [177695]
    automated match to d1jfxa_
    complexed with mes

Details for d3hmca_

PDB Entry: 3hmc (more details), 1.44 Å

PDB Description: Endolysin from Bacillus anthracis
PDB Compounds: (A:) Putative prophage LambdaBa04, glycosyl hydrolase, family 25

SCOPe Domain Sequences for d3hmca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hmca_ c.1.8.0 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
shmghiidiskwngdinwsiakqhidfiiarvqdgsnyvdplykgyvqamkqhgipfgny
afcrfvsiadakkeaqdfwnrgdksatvwvadvevktmndmragtqafidelyrlgakkv
glyvghhmytpfgmanvksdfvwipryggnkpaypcdiwqytetgnvpgigkcdlnslig
nkslswfte

SCOPe Domain Coordinates for d3hmca_:

Click to download the PDB-style file with coordinates for d3hmca_.
(The format of our PDB-style files is described here.)

Timeline for d3hmca_: