Lineage for d1bf5a1 (1bf5 A:136-316)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48354Fold a.47: STAT-like [47654] (2 superfamilies)
  4. 48355Superfamily a.47.1: STAT [47655] (1 family) (S)
  5. 48356Family a.47.1.1: STAT [47656] (2 proteins)
  6. 48357Protein STAT-1, coiled coil domain [47657] (1 species)
  7. 48358Species Human (Homo sapiens) [TaxId:9606] [47658] (1 PDB entry)
  8. 48359Domain d1bf5a1: 1bf5 A:136-316 [17766]
    Other proteins in same PDB: d1bf5a2, d1bf5a3

Details for d1bf5a1

PDB Entry: 1bf5 (more details), 2.9 Å

PDB Description: tyrosine phosphorylated stat-1/dna complex

SCOP Domain Sequences for d1bf5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bf5a1 a.47.1.1 (A:136-316) STAT-1, coiled coil domain {Human (Homo sapiens)}
ldkqkeldskvrnvkdkvmcieheiksledlqdeydfkcktlqnrehlllkkmylmldnk
rkevvhkiiellnvteltqnalindelvewkrrqqsaciggppnacldqlqnwftivaes
lqqvrqqlkkleeleqkytyehdpitknkqvlwdrtfslfqqliqss

SCOP Domain Coordinates for d1bf5a1:

Click to download the PDB-style file with coordinates for d1bf5a1.
(The format of our PDB-style files is described here.)

Timeline for d1bf5a1: