Lineage for d3hkwb_ (3hkw B:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1055706Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1055707Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1056177Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 1056369Protein automated matches [190260] (17 species)
    not a true protein
  7. 1056416Species Hepatitis c virus subtype 1a [TaxId:31646] [189338] (1 PDB entry)
  8. 1056418Domain d3hkwb_: 3hkw B: [177658]
    automated match to d1nb4a_
    complexed with gol, ix6, so4

Details for d3hkwb_

PDB Entry: 3hkw (more details), 1.55 Å

PDB Description: hcv ns5b genotype 1a in complex with 1,5 benzodiazepine inhibitor 6
PDB Compounds: (B:) NS5B RNA-dependent RNA polymerase

SCOPe Domain Sequences for d3hkwb_:

Sequence, based on SEQRES records: (download)

>d3hkwb_ e.8.1.4 (B:) automated matches {Hepatitis c virus subtype 1a [TaxId: 31646]}
smsyswtgalvtpcaaeeqklpinalsnsllrhhnmvysttsrsacqrqkkvtfdrlqvl
dshyqdvlkevkaaaskvkanllsveeacsltpphsarskfgygakdvrcharkavthin
svwkdlledsvtpidttimaknevfcvqpekggrkparlivfpdlgvrvcekmalydvvs
klpqavmgssygfqyspgqrveflvqawkskkspmgfsydtrcfdstvtesdirteeaiy
qccdldpqarvaikslterlyvggpltnskgencgyrrcrasgvlttscgntltcyikar
aacraaglqdctmlvcgddlvvicesagvqedaaslrafteamtrysappgdppqpeydl
elitscssnvsvahdgagkrvyyltrdpttplaraawetarhtpvnswlgniimfaptlw
armilmthffsvliardqleqaldceiygacysiepldlppiiqrlhglsafslhsyspg
einrvaaclrklgvpplrawrhrarsvrakllsrggraaicgkylfnwavrtklkltpia
aagqldlsgwftagysggdiyhs

Sequence, based on observed residues (ATOM records): (download)

>d3hkwb_ e.8.1.4 (B:) automated matches {Hepatitis c virus subtype 1a [TaxId: 31646]}
smsyswtgalvtpcaaeeqklpinalsnsllrhhnmvysttsrsacqrqkkvtfdrlqvl
dshyqdvlkevkaaaskvkanllsveeacsltpphsarskfgygakdvrcharkavthin
svwkdlledsvtpidttimaknevfcvqpgrkparlivfpdlgvrvcekmalydvvsklp
qavmgssygfqyspgqrveflvqawkskkspmgfsydtrcfdstvtesdirteeaiyqcc
dldpqarvaikslterlyvggpltnskgencgyrrcrasgvlttscgntltcyikaraac
raaglqdctmlvcgddlvvicesagvqedaaslrafteamtrysappgdppqpeydleli
tscssnvsvahdgagkrvyyltrdpttplaraawetarhtpvnswlgniimfaptlwarm
ilmthffsvliardqleqaldceiygacysiepldlppiiqrlhglsafslhsyspgein
rvaaclrklgvpplrawrhrarsvrakllsrggraaicgkylfnwavrtklkltpiaaag
qldlsgwftagysggdiyhs

SCOPe Domain Coordinates for d3hkwb_:

Click to download the PDB-style file with coordinates for d3hkwb_.
(The format of our PDB-style files is described here.)

Timeline for d3hkwb_: