SCOPe 2.07: Domain d1azyb1: 1azy B:2-70

Lineage for d1azyb1 (1azy B:2-70)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
   4 helices; bundle, left-handed twist; right-handed superhelix

4. Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families)
   automatically mapped to Pfam PF02885

5. Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)

6. Protein Thymidine phosphorylase [47650] (2 species)

7. Species Escherichia coli [TaxId:562] [47651] (7 PDB entries)

8. Domain d1azyb1: 1azy B:2-70 [17762]
   Other proteins in same PDB: d1azya2, d1azya3, d1azya4, d1azyb2, d1azyb3, d1azyb4

Details for d1azyb1

PDB Entry: 1azy, 3 Å

PDB Description: structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase

PDB Compounds: (B:) thymidine phosphorylase

SCOPe Domain Sequences for d1azyb1:

Sequence; same for both SEQRES and ATOM records:

>d1azyb1 a.46.2.1 (B:2-70) Thymidine phosphorylase {Escherichia coli [TaxId: 562]}
flaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervsltm
amrdsgtvl

Timeline for d1azyb1:

• d1azyb1 first appeared (with stable ids) in SCOP 1.55
  
• d1azyb1 appears in SCOPe 2.06
  
• d1azyb1 appears in the current release, SCOPe 2.08