| Class g: Small proteins [56992] (90 folds) |
| Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family) ![]() |
| Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (3 proteins) Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204) |
| Protein Ribosome biogenesis protein Nop10 [144214] (2 species) |
| Species Pyrococcus furiosus [TaxId:2261] [144215] (10 PDB entries) Uniprot Q8U1R4 4-55 |
| Domain d3hjwb_: 3hjw B: [177619] automated match to d2hvyc1 protein/RNA complex; complexed with k, zn |
PDB Entry: 3hjw (more details), 2.35 Å
SCOPe Domain Sequences for d3hjwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hjwb_ g.41.16.1 (B:) Ribosome biogenesis protein Nop10 {Pyrococcus furiosus [TaxId: 2261]}
frirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi
Timeline for d3hjwb_: